PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy014145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 218aa    MW: 24620.1 Da    PI: 8.0863
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59539946PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.2e-32144202159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  Ahy014145 144 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 202
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-34129202IPR003657WRKY domain
SuperFamilySSF1182901.22E-28136202IPR003657WRKY domain
PROSITE profilePS5081129.585139201IPR003657WRKY domain
SMARTSM007746.3E-38144203IPR003657WRKY domain
PfamPF031062.8E-25145201IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGFVHFEDHN QVLSFLTPSL AAPPTLSHHS LEDVRGDSNS TANTIIAAAT TSTATATVTA  60
TTTVGFGHDE LVPRATWKND DQVRSMDPKG MNNNNDENCT GNSSDGNNSS WWRNGGSEKG  120
KVKVRRKLRE PRFCFQTRSD VDVLDDGYKW RKYGQKVVKN SLHPRSYYRC THNNCRVKKR  180
VERLSEDCRM VITTYEGRHN HSPCDDSNSS EHECFTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-26135201874Probable WRKY transcription factor 4
1wj2_A2e-26135201874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128KVRRKLR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015938773.11e-162PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY41e-68WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0B2PRL91e-104A0A0B2PRL9_GLYSO; Putative WRKY transcription factor 12
STRINGGLYMA07G13611.11e-103(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.16e-64WRKY family protein